Overview

  • Product name
    Recombinant Human DMRT3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TLARSQSSPFLPNDVTLWNTMTLQQQYQLRSQYVSPFPSNSTSVFRSSPV LPARATEDPRISIPDDGCPFVSKQSIYTEDDYDERSDSSDSRTLNTSS
    • Amino acids
      375 to 472
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DMRT 3
    • DMRT like family A3
    • dmrt3
    • DMRT3_HUMAN
    • DMRTA3
    • Doublesex and mab 3 related transcription factor 3
    • Doublesex- and mab-3-related transcription factor 3
    • MGC142144
    • Testis specific protein
    see all
  • Function
    May regulate transcription during sexual development.
  • Tissue specificity
    Specifically expressed in testis.
  • Sequence similarities
    Belongs to the DMRT family.
    Contains 1 DM DNA-binding domain.
  • Developmental stage
    Expressed in 4 to 5 weeks embryos.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163692 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163692 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up