Overview

  • Product name
    Recombinant Human DMT1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATY FNEKISIPEEEYSCF
    • Amino acids
      1 to 65
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab159014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DCT 1
    • dct-1
    • DCT1
    • Divalent cation transporter 1
    • Divalent metal transporter 1
    • DMT 1
    • DMT-1
    • DMT1
    • FLJ37416
    • Natural resistance associated macrophage protein 2
    • Natural resistance-associated macrophage protein 2
    • NRAM2_HUMAN
    • NRAMP 2
    • NRAMP2
    • OK/SW-cl.20
    • Slc11a2
    • Solute carrier family 11 (proton coupled divalent metal ion transporters) member 2
    • Solute carrier family 11 member 2
    see all
  • Function
    Important in metal transport, in particular iron. Can also transport manganese, cobalt, cadmium, nickel, vanadium and lead. Involved in apical iron uptake into duodenal enterocytes. Involved in iron transport from acidified endosomes into the cytoplasm of erythroid precursor cells. May play an important role in hepatic iron accumulation and tissue iron distribution.
  • Tissue specificity
    Ubiquitously expressed. Isoform 1 is highly expressed in brain. Isoform 2 is highly expressed in spleen, thymus and pancreas. Isoform 3 and isoform 4 are abundantly expressed in duodenum and kidney.
  • Involvement in disease
    Defects in SLC11A2 are a cause of hypochromic microcytic anemia (HCMA) [MIM:206100]. The disease is characterized by an abnormal hemoglobin content in the erythrocytes which are reduced in size. It may be hereditary or acquired. Mutations in SLC11A2 are associated with progressive liver iron overload and normal to moderately elevated serum ferritin levels.
  • Sequence similarities
    Belongs to the NRAMP family.
  • Post-translational
    modifications
    Ubiquitinated by WWP2.
  • Cellular localization
    Endosome membrane.
  • Information by UniProt

Images

  • ab159014 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up