Recombinant Human DNA Ligase III protein (ab91933)

Overview

  • Product name
    Recombinant Human DNA Ligase III protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEV DEFLLRLSKL TKEDEQQQALQDIASRCTANDLKCIIRLIKHDLKMNSG AKHVLDALDPNAYEAFKASRNL QDVVERVLHNAQEVEKEPGQRRALSV QASLMTPVQPMLAEACKSVEYAMKKCPNGMFSEI KYDGERVQVHKNGD HFSYFSRSLKPVLPHKVAHFKDYIPQAFPGGHSMILDSEVLLIDNK TG KPLPFGTLGVHKKAAFQDANVCLFVFDCIYFNDVSLMDRPLCERRKFLHD NMVEIPNR IMFSEMKRVTKALDLADMITRVIQEGLEGLVLKDVKGTYE PGKRHWLKVKKDYLNEGAMA DTADLVVLGAFYGQGSKGGMMSIFLMGC YDPGSQKWCTVTKCAGGHDDATLARLQNELDM VKISKDPSKIPSWLKV NKIYYPDFIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRC TRIR DDKDWKSATNLPQLKELYQLSKEKADFTVVAGDEGSSTTGGSSEENKGPS GSAVSR KAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPSAMKVGEKLA TKSSPVKVGEKRKAADET LCQTKRRPASEQRGRTVPAGRR
    • Amino acids
      328 to 949

Specifications

Our Abpromise guarantee covers the use of ab91933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • Reconstitution
    Reconstitute with 105 µl aqua dest.

General Info

  • Alternative names
    • D11Wsu78e
    • DNA ligase
    • DNA ligase 3
    • DNA ligase III
    • DNLI3_HUMAN
    • LIG 3
    • LIG2
    • LIG3
    • Ligase II, DNA, ATP dependent
    • Ligase III DNA ATP dependent
    • MGC78176
    • OTTMUSP00000000875
    • Polydeoxyribonucleotide synthase
    • Polydeoxyribonucleotide synthase [ATP]
    • Polydeoxyribonucleotide synthase [ATP] 3
    • RP23-316C11.6
    see all
  • Function
    Interacts with DNA-repair protein XRCC1 and can correct defective DNA strand-break repair and sister chromatid exchange following treatment with ionizing radiation and alkylating agents.
  • Tissue specificity
    Testis, thymus, prostate and heart.
  • Sequence similarities
    Belongs to the ATP-dependent DNA ligase family.
    Contains 1 BRCT domain.
    Contains 1 PARP-type zinc finger.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab91933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab91933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up