Recombinant Human DNA Ligase III protein (ab91933)

Overview

  • Product name
    Recombinant Human DNA Ligase III protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEV DEFLLRLSKL TKEDEQQQALQDIASRCTANDLKCIIRLIKHDLKMNSG AKHVLDALDPNAYEAFKASRNL QDVVERVLHNAQEVEKEPGQRRALSV QASLMTPVQPMLAEACKSVEYAMKKCPNGMFSEI KYDGERVQVHKNGD HFSYFSRSLKPVLPHKVAHFKDYIPQAFPGGHSMILDSEVLLIDNK TG KPLPFGTLGVHKKAAFQDANVCLFVFDCIYFNDVSLMDRPLCERRKFLHD NMVEIPNR IMFSEMKRVTKALDLADMITRVIQEGLEGLVLKDVKGTYE PGKRHWLKVKKDYLNEGAMA DTADLVVLGAFYGQGSKGGMMSIFLMGC YDPGSQKWCTVTKCAGGHDDATLARLQNELDM VKISKDPSKIPSWLKV NKIYYPDFIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRC TRIR DDKDWKSATNLPQLKELYQLSKEKADFTVVAGDEGSSTTGGSSEENKGPS GSAVSR KAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPSAMKVGEKLA TKSSPVKVGEKRKAADET LCQTKRRPASEQRGRTVPAGRR
    • Amino acids
      328 to 949

Specifications

Our Abpromise guarantee covers the use of ab91933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • Reconstitution
    Reconstitute with 105 µl aqua dest.

General Info

  • Alternative names
    • D11Wsu78e
    • DNA ligase
    • DNA ligase 3
    • DNA ligase III
    • DNLI3_HUMAN
    • LIG 3
    • LIG2
    • LIG3
    • Ligase II, DNA, ATP dependent
    • Ligase III DNA ATP dependent
    • MGC78176
    • OTTMUSP00000000875
    • Polydeoxyribonucleotide synthase
    • Polydeoxyribonucleotide synthase [ATP]
    • Polydeoxyribonucleotide synthase [ATP] 3
    • RP23-316C11.6
    see all
  • Function
    Interacts with DNA-repair protein XRCC1 and can correct defective DNA strand-break repair and sister chromatid exchange following treatment with ionizing radiation and alkylating agents.
  • Tissue specificity
    Testis, thymus, prostate and heart.
  • Sequence similarities
    Belongs to the ATP-dependent DNA ligase family.
    Contains 1 BRCT domain.
    Contains 1 PARP-type zinc finger.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human DNA Ligase III protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human DNA Ligase III protein (ab91933)

ab91933 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab91933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up