Recombinant Human DNA PKcs protein (ab114159)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP78527
    • SpeciesHuman
    • SequenceKMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGH EKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILG RTWEGWEPWM
    • Molecular weight38 kDa including tags
    • Amino acids4019 to 4128
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114159 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114159 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DNA dependent protein kinase catalytic subunit
    • DNA PK catalytic subunit
    • DNA-dependent protein kinase catalytic subunit
    • DNA-PK catalytic subunit
    • DNA-PKcs
    • DNAPK
    • DNAPK catalytic subunit
    • DNPK 1
    • DNPK1
    • Hyper radiosensitivity of murine scid mutation, complementing 1
    • HYRC
    • HYRC 1
    • HYRC1
    • IMD26
    • p350
    • p460
    • PKRDC
    • PRKDC
    • PRKDC_HUMAN
    • Protein Kinase DNA Activated Catalytic Polypeptide
    • XRCC 7
    • XRCC7
    see all
  • FunctionSerine/threonine-protein kinase that acts as a molecular sensor for DNA damage. Involved in DNA nonhomologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. Must be bound to DNA to express its catalytic properties. Promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). The assembly of the DNA-PK complex at DNA ends is also required for the NHEJ ligation step. Required to protect and align broken ends of DNA. May also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. Found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. Also involved in modulation of transcription. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX, thereby regulating DNA damage response mechanism. Phosphorylates DCLRE1C, c-Abl/ABL1, histone H1, HSPCA, c-jun/JUN, p53/TP53, PARP1, POU2F1, DHX9, SRF, XRCC1, XRCC1, XRCC4, XRCC5, XRCC6, WRN, MYC and RFA2. Can phosphorylate C1D not only in the presence of linear DNA but also in the presence of supercoiled DNA. Ability to phosphorylate p53/TP53 in the presence of supercoiled DNA is dependent on C1D.
  • Sequence similaritiesBelongs to the PI3/PI4-kinase family.
    Contains 1 FAT domain.
    Contains 1 FATC domain.
    Contains 2 HEAT repeats.
    Contains 1 PI3K/PI4K domain.
    Contains 3 TPR repeats.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR. Autophosphorylated on Thr-2609, Thr-2638 and Thr-2647. Thr-2609 is a DNA damage-inducible phosphorylation site (inducible with ionizing radiation, IR). Autophosphorylation induces a conformational change that leads to remodeling of the DNA-PK complex, requisite for efficient end processing and DNA repair.
    S-nitrosylated by GAPDH.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human DNA PKcs protein images

  • 12.5% SDS-PAGE analysis of ab114159, stained with Coomassie Blue.

References for Recombinant Human DNA PKcs protein (ab114159)

ab114159 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114159.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"