Recombinant Human DNA polymerase alpha/POLA protein (ab114839)
Key features and details
- Expression system: Wheat germ
- Suitable for: ELISA, SDS-PAGE, WB
Description
-
Product name
Recombinant Human DNA polymerase alpha/POLA protein -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDH EKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS -
Predicted molecular weight
37 kDa including tags -
Amino acids
1363 to 1462
-
Specifications
Our Abpromise guarantee covers the use of ab114839 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
SDS-PAGE
Western blot
-
Form
Liquid -
Additional notes
This product was previously labelled as DNA polymerase alpha.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.3% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- DKFZp686K1672
- DNA polymerase alpha 1 catalytic subunit
- DNA polymerase alpha catalytic subunit
see all -
Function
Plays an essential role in the initiation of DNA replication. During the S phase of the cell cycle, the DNA polymerase alpha complex (composed of a catalytic subunit POLA1/p180, a regulatory subunit POLA2/p70 and two primase subunits PRIM1/p49 and PRIM2/p58) is recruited to DNA at the replicative forks via direct interactions with MCM10 and WDHD1. The primase subunit of the polymerase alpha complex initiates DNA synthesis by oligomerising short RNA primers on both leading and lagging strands. These primers are initially extended by the polymerase alpha catalytic subunit and subsequently transferred to polymerase delta and polymerase epsilon for processive synthesis on the lagging and leading strand, respectively. The reason this transfer occurs is because the polymerase alpha has limited processivity and lacks intrinsic 3' exonuclease activity for proofreading error, and therefore is not well suited for replicating long complexes. -
Sequence similarities
Belongs to the DNA polymerase type-B family. -
Post-translational
modificationsA 165 kDa form is probably produced by proteolytic cleavage at Lys-124. -
Cellular localization
Nucleus. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab114839 has not yet been referenced specifically in any publications.