Recombinant Human DNA polymerase alpha protein (ab114839)

Overview

  • Product nameRecombinant Human DNA polymerase alpha protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP09884
    • SpeciesHuman
    • SequenceQFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDH EKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS
    • Molecular weight37 kDa including tags
    • Amino acids1363 to 1462

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114839 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686K1672
    • DNA polymerase alpha 1 catalytic subunit
    • DNA polymerase alpha catalytic subunit
    • DNA polymerase alpha catalytic subunit p180
    • DNA polymerase alpha p180 subunit
    • DPOLA_HUMAN
    • OTTHUMP00000023089
    • OTTHUMP00000023090
    • P180
    • p180 subunit
    • POLA
    • POLA1
    • Polymerase (DNA directed), alpha 1, catalytic subunit
    • Polymerase (DNA-directed), alpha (70kD)
    see all
  • FunctionPlays an essential role in the initiation of DNA replication. During the S phase of the cell cycle, the DNA polymerase alpha complex (composed of a catalytic subunit POLA1/p180, a regulatory subunit POLA2/p70 and two primase subunits PRIM1/p49 and PRIM2/p58) is recruited to DNA at the replicative forks via direct interactions with MCM10 and WDHD1. The primase subunit of the polymerase alpha complex initiates DNA synthesis by oligomerising short RNA primers on both leading and lagging strands. These primers are initially extended by the polymerase alpha catalytic subunit and subsequently transferred to polymerase delta and polymerase epsilon for processive synthesis on the lagging and leading strand, respectively. The reason this transfer occurs is because the polymerase alpha has limited processivity and lacks intrinsic 3' exonuclease activity for proofreading error, and therefore is not well suited for replicating long complexes.
  • Sequence similaritiesBelongs to the DNA polymerase type-B family.
  • Post-translational
    modifications
    A 165 kDa form is probably produced by proteolytic cleavage at Lys-124.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human DNA polymerase alpha protein images

  • ab114839 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human DNA polymerase alpha protein (ab114839)

ab114839 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114839.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"