Recombinant Human DNA polymerase delta p50 protein (ab114798)

Overview

  • Product nameRecombinant Human DNA polymerase delta p50 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP49005
    • SpeciesHuman
    • SequenceMFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQY AHIYATRLIQMRPFLENRAQQHWGSGVGVKKLCELQPEEKCCVVGTLFKA MPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDV SKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVS GLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSH STQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFD PTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVS DIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPH VYFCGNTPSFGSKIIRGPEDQTVLLVTVPDFSATQTACLVNLRSLACQPI SFSGFGAEDDDLGGLGLGP
    • Molecular weight78 kDa including tags
    • Amino acids1 to 469

Specifications

Our Abpromise guarantee covers the use of ab114798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DNA polymerase delta subunit 2
    • DNA polymerase delta subunit p50
    • DNA polymerase subunit delta 2
    • DNA polymerase subunit delta p50
    • DPOD2_HUMAN
    • POLD 2
    • pold2
    see all
  • FunctionThe function of the small subunit is not yet clear.
  • Sequence similaritiesBelongs to the DNA polymerase delta/II small subunit family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human DNA polymerase delta p50 protein images

  • ab114798 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human DNA polymerase delta p50 protein (ab114798)

ab114798 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114798.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"