Recombinant Human DNA polymerase delta p50 protein (ab114798)

Overview

  • Product name
    Recombinant Human DNA polymerase delta p50 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQY AHIYATRLIQMRPFLENRAQQHWGSGVGVKKLCELQPEEKCCVVGTLFKA MPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDV SKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVS GLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSH STQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFD PTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVS DIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPH VYFCGNTPSFGSKIIRGPEDQTVLLVTVPDFSATQTACLVNLRSLACQPI SFSGFGAEDDDLGGLGLGP
    • Molecular weight
      78 kDa including tags
    • Amino acids
      1 to 469

Specifications

Our Abpromise guarantee covers the use of ab114798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DNA polymerase delta subunit 2
    • DNA polymerase delta subunit p50
    • DNA polymerase subunit delta 2
    • DNA polymerase subunit delta p50
    • DPOD2_HUMAN
    • POLD 2
    • pold2
    see all
  • Function
    The function of the small subunit is not yet clear.
  • Sequence similarities
    Belongs to the DNA polymerase delta/II small subunit family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114798 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114798 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114798.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up