Recombinant Human DNA Polymerase lambda protein (ab113399)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9UGP5-2
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMLMHHQKYLQRFLGGKREKKQKEACSIPGI GKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQ GFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQA FNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEG FLTDDLVSQEENGQQQKYLGVCRLPGPGRRHRRLDIIVVPYSEFACALLY FTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLPTPT EKDVFRLLGLPYREPAERDW
    • Molecular weight36 kDa
    • Amino acids1 to 300
    • TagsHis tag N-Terminus
    • Additional sequence informationThe protein sequence refers to isoform 2 and contains MGSSHHHHHHSSGLVPRGSH sequence at N-Terminus for the His tag.

Specifications

Our Abpromise guarantee covers the use of ab113399 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    Conventional chromatography techniques (anion exchange followed by gel filtration with 20mM Tris pH 7.5, 2mM EDTA).
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 0.58% Sodium chloride, 30% Glycerol

General Info

  • Alternative names
    • BETA N
    • BETAN
    • DNA directed DNA polymerase lambda
    • DNA polymerase beta 2
    • DNA polymerase beta-2
    • DNA polymerase kappa
    • DNA polymerase kappa DNA polymerase beta N
    • DNA polymerase lambda
    • DNA polymerase lamda2
    • DPOLL_HUMAN
    • EC 2.7.7.7,EC 4.2.99.
    • FLJ46002
    • OTTHUMP00000020321
    • OTTHUMP00000020323
    • OTTHUMP00000059179
    • Pol beta2
    • POL KAPPA
    • Pol Lambda
    • POLKAPPA
    • POLL
    • Polymerase DNA directed lambda
    see all
  • FunctionRepair polymerase. Involved in base excision repair (BER) responsible for repair of lesions that give rise to abasic (AP) sites in DNA. Has both DNA polymerase and terminal transferase activities. Has a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity.
  • Tissue specificityExpressed in a number of tissues. Abundant in testis.
  • Sequence similaritiesBelongs to the DNA polymerase type-X family.
    Contains 1 BRCT domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human DNA Polymerase lambda protein images

  • 15% SDS-PAGE of DNA Polymerase lambda protein: (1) MW ladder, (2) protein loaded 3ug

References for Recombinant Human DNA Polymerase lambda protein (ab113399)

ab113399 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113399.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"