Recombinant Human DNA Primase protein (ab159186)

Overview

  • Product name
    Recombinant Human DNA Primase protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRV KLLKSVENLGVSYVKGTEQYQSKLESELRKLKFSYRENLEDEYEPRRRDH ISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKIQDFLKDSQLQ FEAVSIFL
    • Amino acids
      1 to 158
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159186 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • dJ422B11.1.1
    • DNA primase 58kDa subunit
    • DNA primase large subunit
    • DNA primase p58
    • DNA primase subunit p58
    • p58
    • Polypeptide 2A p58
    • PRIM2
    • PRIM2A
    • Primase DNA polypeptide 2 (58kDa)
    • Primase polpeptide 2A (58kD)
    • Primase polpeptide 2A 58kDa
    see all
  • Relevance
    DNA primase synthesizes small ribonucleotide primers for the initiation of DNA replication. The eukaryotic primase is a heterodimer of a small and a large subunit, p49 and p58 respectively. These two subunits purify as a complex tightly bound to DNA polymerase alpha. This tight association implicates polymerase alpha as the lagging-strand DNA polymerase in replication. Uniquely, primases are able to synthesize nucleotides de novo on a template by the formation of an initial dinucleotide. DNA primase initiates synthesis with a triphosphate purine moiety at the 5'-end. After synthesis of 7-10 ribonucleotides, the primer template is translocated intramolecularly to the active site of the DNA polymerase alpha subunit. The p49 subunit of DNA primase contains the catalytic active site. The human primase subunits are 90% identical in amino acid sequence to the mouse homologs.

Images

  • ab159186 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159186 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159186.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up