Recombinant Human DNAJB11 protein (ab105636)

Overview

  • Product name
    Recombinant Human DNAJB11 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGRDFYKILGVPRSASIKDIKKAYRKLALQ LHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSS HGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFV EVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKL VNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPIF ERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWK KGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKV YNGLQGY
    • Molecular weight
      41 kDa including tags
    • Amino acids
      23 to 358
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105636 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8

General Info

  • Alternative names
    • ABBP-2
    • ABBP2
    • APOBEC1 binding protein 2
    • APOBEC1-binding protein 2
    • DJ9
    • DJB11_HUMAN
    • DnaJ (Hsp40) homolog subfamily B member 11
    • DnaJ homolog subfamily B member 11
    • DnaJ protein homolog 9
    • DNAJB11
    • EDJ
    • ER associated DNAJ
    • ER associated dnaJ protein 3
    • ER associated Hsp40 co chaperone
    • ER-associated DNAJ
    • ER-associated dnaJ protein 3
    • ER-associated Hsp40 co-chaperone
    • ERdj3
    • ERJ3
    • ERj3p
    • hDj-9
    • hDj9
    • HEDJ
    • Human DnaJ protein 9
    • PWP1 interacting protein 4
    • PWP1-interacting protein 4
    see all
  • Function
    Serves as a co-chaperone for HSPA5. Binds directly to both unfolded proteins that are substrates for ERAD and nascent unfolded peptide chains, but dissociates from the HSPA5-unfolded protein complex before folding is completed. May help recruiting HSPA5 and other chaperones to the substrate. Stimulates HSPA5 ATPase activity.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Contains 1 J domain.
  • Post-translational
    modifications
    Contains high-mannose Endo H-sensitive carbohydrates.
    Cys-169, Cys-171, Cys-193 and Cys-196 form intramolecular disulfide bonds. The preferential partner for each Cys is not known.
    Thr-188 was reported (PubMed:17525332) to be phosphorylated upon DNA damage by ATM or ATR; however as this position has been shown to be in the ER lumen, the in vivo relevance is not proven.
  • Cellular localization
    Endoplasmic reticulum lumen. Associated with the ER membrane in a C-terminally epitope-tagged construct.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab105636 (3ug)

References

ab105636 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105636.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up