Recombinant Human DNAJB11 protein (ab105636)

Overview

  • Product nameRecombinant Human DNAJB11 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9UBS4
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGRDFYKILGVPRSASIKDIKKAYRKLALQ LHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSS HGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFV EVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKL VNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPIF ERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWK KGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKV YNGLQGY
    • Molecular weight41 kDa including tags
    • Amino acids23 to 358
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105636 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8

General Info

  • Alternative names
    • ABBP-2
    • ABBP2
    • APOBEC1 binding protein 2
    • APOBEC1-binding protein 2
    • DJ9
    • DJB11_HUMAN
    • DnaJ (Hsp40) homolog subfamily B member 11
    • DnaJ homolog subfamily B member 11
    • DnaJ protein homolog 9
    • DNAJB11
    • EDJ
    • ER associated DNAJ
    • ER associated dnaJ protein 3
    • ER associated Hsp40 co chaperone
    • ER-associated DNAJ
    • ER-associated dnaJ protein 3
    • ER-associated Hsp40 co-chaperone
    • ERdj3
    • ERJ3
    • ERj3p
    • hDj-9
    • hDj9
    • HEDJ
    • Human DnaJ protein 9
    • PWP1 interacting protein 4
    • PWP1-interacting protein 4
    see all
  • FunctionServes as a co-chaperone for HSPA5. Binds directly to both unfolded proteins that are substrates for ERAD and nascent unfolded peptide chains, but dissociates from the HSPA5-unfolded protein complex before folding is completed. May help recruiting HSPA5 and other chaperones to the substrate. Stimulates HSPA5 ATPase activity.
  • Tissue specificityWidely expressed.
  • Sequence similaritiesContains 1 J domain.
  • Post-translational
    modifications
    Contains high-mannose Endo H-sensitive carbohydrates.
    Cys-169, Cys-171, Cys-193 and Cys-196 form intramolecular disulfide bonds. The preferential partner for each Cys is not known.
    Thr-188 was reported (PubMed:17525332) to be phosphorylated upon DNA damage by ATM or ATR; however as this position has been shown to be in the ER lumen, the in vivo relevance is not proven.
  • Cellular localizationEndoplasmic reticulum lumen. Associated with the ER membrane in a C-terminally epitope-tagged construct.
  • Information by UniProt

Recombinant Human DNAJB11 protein images

  • 15% SDS-PAGE analysis of ab105636 (3ug)

References for Recombinant Human DNAJB11 protein (ab105636)

ab105636 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105636.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"