Recombinant Human DNAJB2 protein (ab101215)

Overview

  • Product nameRecombinant Human DNAJB2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP25686
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMASYYEILDVPRSASADDIKKAYRRKA LQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGREGLTGTG TGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELDDLGPFSELQN RGSRHSGPFFTFSSSFPGHSDFSSSSFSFSPGAGAFRSSTSTTFVQGRRI TTRRIMENGQERVEVEEDGQLKSVTINGVPDDLALGLELSRREQQPSVTS RSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPADVF
    • Molecular weight33 kDa including tags
    • Amino acids1 to 277
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101215 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101215 was purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: 0% None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Descriptions
    • DnaJ (Hsp40) homolog subfamily B member 2
    • DnaJ homolog subfamily B member 2
    • DnaJ protein homolog 1
    • DNAJB2
    • Heat shock 40 kDa protein 3
    • Heat shock protein J1
    • Heat shock protein neuronal DNAJ like 1
    • HSJ 1
    • HSJ1
    • HSPF3
    see all
  • RelevanceDNAJB2 is involved in heat shock protein and unfolded protein binding.

Recombinant Human DNAJB2 protein images

  • ab101215 at 3 µg analysed by SDS PAGE.

References for Recombinant Human DNAJB2 protein (ab101215)

ab101215 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101215.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"