Recombinant Human DNAJB8 protein (ab113587)

Overview

  • Product name
    Recombinant Human DNAJB8 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMANYYEVLGVQASASPEDIKKAYRKLALRW HPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKRSLYDRAGCDSWRAGGGAS TPYHSPFDTGYTFRNPEDIFREFFGGLDPFSFEFWDSPFNSDRGGRGHGL RGAFSAGFGEFPAFMEAFSSFNMLGCSGGSHTTFSSTSFGGSSSGSSGFK SVMSSTEMINGHKVTTKRIVENGQERVEVEEDGQLKSVTVNGKEQLKWMD SK
    • Molecular weight
      28 kDa including tags
    • Amino acids
      1 to 232
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113587 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113587 was purified by using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • DJ6
    • DnaJ (Hsp40) homolog, subfamily B, member 8
    • DnaJ homolog subfamily B member 8
    • Dnajb8
    • DNJB8_HUMAN
    • mDj6
    • MGC33884
    • OTTHUMP00000216243
    see all
  • Sequence similarities
    Contains 1 J domain.
  • Information by UniProt

Images

  • ab113587 at 3 µg analysed by 15% SDS-PAGE.

References

ab113587 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113587.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up