Recombinant Human DNAJB8 protein (ab113587)

Overview

  • Product nameRecombinant Human DNAJB8 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8NHS0
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMANYYEVLGVQASASPEDIKKAYRKLALRW HPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKRSLYDRAGCDSWRAGGGAS TPYHSPFDTGYTFRNPEDIFREFFGGLDPFSFEFWDSPFNSDRGGRGHGL RGAFSAGFGEFPAFMEAFSSFNMLGCSGGSHTTFSSTSFGGSSSGSSGFK SVMSSTEMINGHKVTTKRIVENGQERVEVEEDGQLKSVTVNGKEQLKWMD SK
    • Molecular weight28 kDa including tags
    • Amino acids1 to 232
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113587 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab113587 was purified by using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • DJ6
    • DnaJ (Hsp40) homolog, subfamily B, member 8
    • DnaJ homolog subfamily B member 8
    • Dnajb8
    • DNJB8_HUMAN
    • mDj6
    • MGC33884
    • OTTHUMP00000216243
    see all
  • Sequence similaritiesContains 1 J domain.
  • Information by UniProt

Recombinant Human DNAJB8 protein images

  • ab113587 at 3 µg analysed by 15% SDS-PAGE.

References for Recombinant Human DNAJB8 protein (ab113587)

ab113587 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113587.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"