Recombinant Human DNAJB9 protein (ab116936)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGG GLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNM VTTYTDCSGQ
    • Molecular weight
      38 kDa including tags
    • Amino acids
      114 to 223

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116936 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZP564F1862
    • DnaJ (Hsp40) homolog subfamily B member 9
    • DnaJ homolog subfamily B member 9
    • DNAJB9
    • DNJB9_HUMAN
    • eEndoplasmic reticulum DNA J domain containing protein 4
    • Endoplasmic reticulum DnaJ homolog 4
    • ER resident protein ERdj4
    • ERdj4
    • MDG 1
    • Mdg-1
    • MDG1
    • Microvascular endothelial differentiation gene 1
    • Microvascular endothelial differentiation gene 1 protein
    • MST049
    • MSTP049
    • OTTHUMP00000206840
    see all
  • Function
    Acts as a co-chaperone with an Hsp70 protein.
  • Sequence similarities
    Contains 1 J domain.
  • Cellular localization
    Cytoplasm. Nucleus. Stress induces its translocation to the nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116936 at approximately 37.73 kDa.

References

ab116936 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116936.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up