Recombinant Human DNAJB9 protein (ab116936)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9UBS3
    • SpeciesHuman
    • SequenceNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGG GLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNM VTTYTDCSGQ
    • Molecular weight38 kDa including tags
    • Amino acids114 to 223

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116936 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZP564F1862
    • DnaJ (Hsp40) homolog subfamily B member 9
    • DnaJ homolog subfamily B member 9
    • DNAJB9
    • DNJB9_HUMAN
    • eEndoplasmic reticulum DNA J domain containing protein 4
    • Endoplasmic reticulum DnaJ homolog 4
    • ER resident protein ERdj4
    • ERdj4
    • MDG 1
    • Mdg-1
    • MDG1
    • Microvascular endothelial differentiation gene 1
    • Microvascular endothelial differentiation gene 1 protein
    • MST049
    • MSTP049
    • OTTHUMP00000206840
    see all
  • FunctionActs as a co-chaperone with an Hsp70 protein.
  • Sequence similaritiesContains 1 J domain.
  • Cellular localizationCytoplasm. Nucleus. Stress induces its translocation to the nucleus.
  • Information by UniProt

Recombinant Human DNAJB9 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116936 at approximately 37.73 kDa.

References for Recombinant Human DNAJB9 protein (ab116936)

ab116936 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116936.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"