Recombinant Human DNAJC10 protein (ab162736)

Overview

  • Product name
    Recombinant Human DNAJC10 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQK AGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGK RNKDEL
    • Amino acids
      688 to 793
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162736 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp434J1813
    • DnaJ (Hsp40) homolog subfamily C member 10
    • DnaJ homolog subfamily C member 10
    • DNAJC 10
    • ER resident protein ERdj5
    • ERdj 5
    • ERdj5
    • J domain containing protein disulfide isomerase like protein
    • JPDI
    • Macrothioredoxin
    • MGC104194
    • MTHr
    see all
  • Relevance
    DNAJC10 (DnaJ homolog, subfamily C, member 10) is a co-chaperone which is thought to have a role in protein folding and translocation across the endoplasmic reticulum membrane. It may act as a co-chaperone for HSPA5.
  • Cellular localization
    Secreted. Endoplasmic reticulum lumen.

Images

  • ab162736 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162736 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162736.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up