Recombinant Human DNAJC15 protein (ab171593)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSFRIWKPLEQVITETAKKISTPSFSSYY KGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVA AKINEAKDLLETTTKH
    • Molecular weight
      13 kDa including tags
    • Amino acids
      58 to 150
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171593 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab171593 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • Cell growth inhibiting gene 22 protein
    • Cell growth-inhibiting gene 22 protein
    • DJC15_HUMAN
    • DnaJ (Hsp40) homolog subfamily C member 15
    • DNAJ domain containing
    • DnaJ homolog subfamily C member 15
    • DNAJC15
    • DNAJD1
    • GIG22
    • HSD18
    • MCJ
    • Methylation controlled J protein
    • Methylation-controlled J protein
    see all
  • Function
    Negative regulator of the mitochondrial respiratory chain. Prevents mitochondrial hyperpolarization state and restricts mitochondrial generation of ATP (By similarity). Acts as an import component of the TIM23 translocase complex. Stimulates the ATPase activity of HSPA9.
  • Tissue specificity
    Expressed at highest levels in heart, followed by liver and kidney.
  • Involvement in disease
    Absent or down-regulated in many advanced cases of ovarian adenocarcinoma, due to hypermethylation and allelic loss. Loss of expression correlates with increased resistance to antineoplastic drugs, such as cisplatin.
  • Sequence similarities
    Contains 1 J domain.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab171593 at 3µg.

References

ab171593 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171593.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up