Recombinant Human DNAJC22 protein (ab164169)

Overview

  • Product name
    Recombinant Human DNAJC22 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAKGLLVTYALWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFW KLPSFVAQANRAQGQRQSPRGVTPPLSPIRFAAQVIVGIYFGLVALISLS SMVNFYIVALPLAVGLGVLLVAAVGNQTSDFKNTLGSAFLTSPIFYGRPI AILPISVAASITAQRHRRYKALVASEPLSVRLYRLGLAYLAFTGPLAYSA LCNTAATLSYVAETFGSFLNWFSFFPLLGRLMEFVLLLPYRIWRLLMGET GFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQEL VKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKPWGSRR
    • Amino acids
      1 to 341
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164169 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DJC22_HUMAN
    • DnaJ (Hsp40) homolog, subfamily C, member 22
    • DnaJ homolog subfamily C member 22
    • DNAJC22
    • wurst homolog
    • wus
    see all
  • Function
    May function as a co-chaperone.
  • Sequence similarities
    Contains 1 J domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE with ab164169 detecting DNAJC22. Lane 1 = Tagged protein (5µl/lane). Lane 2 = Tagged protein (15µl/lane). Lane 3 = Tagged non-heat denatured (5µl/lane).

References

ab164169 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164169.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up