Recombinant Human DNAJC3 protein (ab114761)

Overview

  • Product nameRecombinant Human DNAJC3 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13217
    • SpeciesHuman
    • SequenceMVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAA GQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQL KMDFTAARLQRGHLLLKQGKLDEAEDDFKKVVFPVPSLLGLQRSLLDDLY LLFWFFLMKKVTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSC LRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS
    • Molecular weight52 kDa including tags
    • Amino acids1 to 234

Specifications

Our Abpromise guarantee covers the use of ab114761 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DnaJ (Hsp40) homolog subfamily C member 3
    • DnaJ homolog subfamily C member 3
    • DNAJC3
    • DNJC3_HUMAN
    • double-stranded RNA-activated protein kinase inhibitor
    • Endoplasmic reticulum DnaJ protein 6
    • ERdj6
    • HP58
    • Interferon induced, double stranded RNA activated protein kinase inhibitor
    • Interferon-induced
    • P58
    • p58 ipk
    • P58IPK
    • PRKRI
    • Protein kinase inhibitor of 58 kDa
    • Protein kinase inhibitor p58
    • Protein kinase interferon inducible double stranded RNA dependent inhibitor
    see all
  • FunctionInvolved in the unfolded protein response (UPR) during ER stress. Co-chaperone of HSPA8/HSC70, it stimulates its ATPase activity. May inhibit both the autophosphorylation of EIF2AK2/PKR and the ability of EIF2AK2 to catalyze phosphorylation of the EIF2A. May inhibit EIF2AK3/PERK activity.
  • Tissue specificityWidely expressed with high level in the pancreas and testis. Also expressed in cell lines with different levels.
  • Sequence similaritiesContains 1 J domain.
    Contains 9 TPR repeats.
  • DomainThe J domain mediates interaction with HSPA8.
  • Cellular localizationEndoplasmic reticulum.
  • Information by UniProt

Recombinant Human DNAJC3 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114761 at approximately 51.85kDa.

References for Recombinant Human DNAJC3 protein (ab114761)

ab114761 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114761.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"