Recombinant Human DNALI1 protein (ab159889)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQPGPSGSAPQPPKT KLPSTPCVPDPTKQAEEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVV HLQEQLDLKLQQRQARETGICPVRRELYSQCFDELIREVTINCAERGLLL LRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKSDMERKIAELETEK RDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLKRTNQQLKAQL EGIIAPKK
    • Amino acids
      1 to 258
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • axonemal
    • Axonemal dynein light chain
    • Axonemal dynein light chain (hp28)
    • Axonemal dynein light intermediate polypeptide 1
    • dJ423B22.5
    • DNALI 1
    • DNALI1
    • Dynein axonemal light intermediate chain 1
    • Dynein axonemal light intermediate polypeptide 1
    • hp28
    • IDLC_HUMAN
    • Inner dynein arm homolog of clamydomonas
    • Inner dynein arm light chain
    • Inner dynein arm light chain axonemal
    • P28
    see all
  • Function
    May play a dynamic role in flagellar motility.
  • Tissue specificity
    Expressed in many tissues. A smaller 0.9 kb and a larger 2.5 kb transcripts were detected at the highest level in the testis, at medium levels in the prostate, heart, liver, lung and pancreas, at low levels in the ovary, skeletal muscle and small intestine. Not detected in spleen, colon epithelium, thymus or peripheral blood leukocytes. The 0.9 kb transcript is expressed at a 20-fold higher level than the 2.5 kb transcript in the testis.
  • Sequence similarities
    Belongs to the inner dynein arm light chain family.
  • Information by UniProt

Images

  • ab159889 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159889 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up