Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQ CPEGYFGSACEEKVDLCASSPCQNNGTCYVDGVHFTCNCSPGFTGPTCAQ LIDFCALSP
    • Amino acids
      368 to 476
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164917 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bet
    • Brain EGF repeat-containing transmembrane protein
    • Bret
    • Delta and Notch-like epidermal growth factor-related receptor
    • Delta notch like EGF repeat containing transmembrane
    • Delta/notch like EGF repeat containing
    • Delta/notch-like EGF-related receptor
    • Dner
    • DNER_HUMAN
    • PRO299
    • Transmembrane protein Bet
    • UNQ26
    see all
  • Function
    Activator of the NOTCH1 pathway. May mediate neuron-glia interaction during astrocytogenesis.
  • Tissue specificity
    Expressed in brain, spinal cord and adrenal gland.
  • Sequence similarities
    Contains 10 EGF-like domains.
    Contains 1 follistatin-like domain.
  • Cellular localization
    Cell membrane. Present on the membrane of dendrites and cell bodies but excluded from axonal membrane. Also found in early endosomes in the somatodendritic region (By similarity).
  • Information by UniProt

Images

  • ab164917 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164917 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164917.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up