Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO14717
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMEPLRVLELYSGVGGMHHALRESCIP AQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGITLEEFDRLSFDMILMS PPCQPFTRIGRQGDMTDSRTNSFLYILDILPRLQKLPKYILLENVKGFEV SSTRDLLIQTIENCGFQYQEFLLSPTSLGIPNSRLRYFLIAKLQSEPLPF QAPGQVLMEFPKIESVHPQKYAMDVENKIQEKNVEPNISFDGSIQCSGKD AILFKLETAEEIHRKNQQDSDLSVKMLKDFLEDDTDVNQYLLPPKSLLRY ALLLDIVQPTCRRSVCFTKGYGSYIEGTGSVLQTAEDVQVENIYKSLTNL SQEEQITKLLILKLRYFTPKEIANLLGFPPEFGFPEKITVKQRYRLLGNS LNVHVVAKLIKILYE
    • Molecular weight47 kDa including tags
    • Amino acids1 to 391
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124566 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab124566 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • dDNMT
    • DmMT 2
    • DmMT2
    • DNA (cytosine 5 ) methyltransferase 2
    • DNA (cytosine 5) methyltransferase like protein 2
    • DNA (cytosine-5)-methyltransferase-like protein 2
    • DNA 5 cytosine methyltransferase
    • DNA methyltransferase 2
    • DNA methyltransferase homolog HsaIIP
    • DNA MTase homolog HsaIIP
    • Dnmt 2
    • Dnmt2
    • M.HsaIIP
    • MHsaIIP
    • nmt 2
    • nmt2
    • OTTHUMP00000045198
    • PuMet
    • RNMT 1
    • RNMT1
    • TRDMT 1
    • TRDMT_HUMAN
    • TRDMT1
    • tRNA (cytosine 5 ) methyltransferase
    • tRNA (cytosine(38)-C(5))-methyltransferase
    • tRNA aspartic acid methyltransferase 1
    • tRNA aspartic acid methyltransferase 1 variant 1
    • tRNA aspartic acid methyltransferase 1 variant 2
    • tRNA aspartic acid methyltransferase 1 variant 3
    • tRNA aspartic acid methyltransferase 1 variant 4
    • tRNA aspartic acid methyltransferase 1 variant 5
    • tRNA aspartic acid methyltransferase 1 variant 8
    see all
  • FunctionSpecifically methylates cytosine 38 in the anticodon loop of tRNA(Asp).
  • Tissue specificityUbiquitous. Higher expression in testis, ovary and thymus and at much lower levels in spleen, prostate, colon, small intestine, and peripheral blood leukocytes.
  • Sequence similaritiesBelongs to the C5-methyltransferase family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Dnmt2 protein images

  • 15% SDS-PAGE analysis of 3 µg ab124566.

References for Recombinant Human Dnmt2 protein (ab124566)

ab124566 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124566.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"