Recombinant Human Dnmt3L protein (ab112413)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9UJW3
    • SpeciesHuman
    • SequenceLVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSSRHWA LVSEEELSLLAQNKQSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL
    • Molecular weight37 kDa including tags
    • Amino acids288 to 387

Specifications

Our Abpromise guarantee covers the use of ab112413 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityThis product is useful for Antibody Production and Protein Array
  • Applications

    ELISA

    Western blot

    Peptide Array

    SDS-PAGE

  • FormLiquid
  • Additional notesBest used within three months from the date of receipt This product is useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced.

General Info

  • Alternative names
    • Cytosine 5 methyltransferase 3 like protein
    • DNA (cytosine 5 ) methyltransferase 3 like
    • DNA (cytosine-5)-methyltransferase 3-like
    • DNA cytosine 5 methyltransferase 3 like protein
    • DNA methyltransferase 3 like protein
    • DNM3L_HUMAN
    • Dnmt 3L
    • Dnmt3l
    • Human cytosine 5 methyltransferase 3 like protein
    • MGC1090
    see all
  • FunctionCatalytically inactive regulatory factor of DNA methyltransferases. It is essential for the function of DNMT3A and DNMT3B. Activates DNMT3A and DNMT3B by binding to their catalytic domain. Accelerates the binding of DNA and AdoMet to the methyltransferases and dissociates from the complex after DNA binding to the methyltransferases. Recognizes unmethylated histone H3 lysine 4 (H3K4) and induces de novo DNA methylation by recruitment or activation of DNMT3.
  • Tissue specificityExpressed at low levels in several tissues including testis, ovary, and thymus.
  • Sequence similaritiesBelongs to the C5-methyltransferase family.
    Contains 1 ADD-type zinc finger.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Dnmt3L protein images

  • 12.5% SDS-PAGE image, using ab112413. (Stained with Coomassie Blue)

References for Recombinant Human Dnmt3L protein (ab112413)

ab112413 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112413.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"