Recombinant human Dnmt3L protein (ab170406)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAAIPALDPEAEPSMDVILVGSSELSSSVSPGTGRDLIAYEVKANQRNIE DICICCGSLQVHTQHPLFEGGICAPCKDKFLDALFLYDDDGYQSYCSICC SGETLLICGNPDCTRCYCFECVDSLVGPGTSGKVHAMSNWVCYLCLPSSR SGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVLSLFEDIK KELTSLGFLESGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGH TCDRPPSWYLFQFHRLLQYARPKPGSPRPFFWMFVDNLVLNKEDLDVASR FLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNK QSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL
    • Molecular weight
      70 kDa including tags
    • Amino acids
      1 to 386

Specifications

Our Abpromise guarantee covers the use of ab170406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity of ab170406 (0.25 µg) was increased 3-fold when co-incubated with 0.25 µg DNMT3L
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 80 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.03% EDTA, 25% Glycerol, 0.29% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Cytosine 5 methyltransferase 3 like protein
    • DNA (cytosine 5 ) methyltransferase 3 like
    • DNA (cytosine-5)-methyltransferase 3-like
    • DNA cytosine 5 methyltransferase 3 like protein
    • DNA methyltransferase 3 like protein
    • DNM3L_HUMAN
    • Dnmt 3L
    • Dnmt3l
    • Human cytosine 5 methyltransferase 3 like protein
    • MGC1090
    see all
  • Function
    Catalytically inactive regulatory factor of DNA methyltransferases. It is essential for the function of DNMT3A and DNMT3B. Activates DNMT3A and DNMT3B by binding to their catalytic domain. Accelerates the binding of DNA and AdoMet to the methyltransferases and dissociates from the complex after DNA binding to the methyltransferases. Recognizes unmethylated histone H3 lysine 4 (H3K4) and induces de novo DNA methylation by recruitment or activation of DNMT3.
  • Tissue specificity
    Expressed at low levels in several tissues including testis, ovary, and thymus.
  • Sequence similarities
    Belongs to the C5-methyltransferase family.
    Contains 1 ADD-type zinc finger.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • Specific activity of ab170406 (0.25µg) was increased 3-fold when co-incubated with Dnmt3L (0.25µg)
  • SDS-PAGE analysis of ab170406.

References

ab170406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up