Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFK FIVRSRILFNQLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAA LKYLPT
    • Molecular weight
      37 kDa including tags
    • Amino acids
      698 to 803

Specifications

Our Abpromise guarantee covers the use of ab114755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 180 kDa protein downstream of CRK
    • Ced5
    • Dedicator of Cytokinesis 1
    • Dedicator of cytokinesis protein 1
    • DOCK 1
    • DOCK 180
    • DOCK1
    • DOCK1_HUMAN
    • DOCK180
    see all
  • Function
    Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Functions as a guanine nucleotide exchange factor (GEF), which activates Rac Rho small GTPases by exchanging bound GDP for free GTP. Its GEF activity may be enhanced by ELMO1.
  • Tissue specificity
    Highly expressed in placenta, lung, kidney, pancreas and ovary. Expressed at intermediate level in thymus, testes and colon.
  • Sequence similarities
    Belongs to the DOCK family.
    Contains 1 DHR-1 (CZH-1) domain.
    Contains 1 DHR-2 (CZH-2) domain.
    Contains 1 SH3 domain.
  • Domain
    The DHR-2 domain is necessary and sufficient for the GEF activity.
  • Cellular localization
    Cytoplasm. Membrane. Recruited to membranes via its interaction with phosphatidylinositol 3,4,5-triphosphate.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114755 at approximately 37.29kDa.

References

ab114755 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up