Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14185
    • SpeciesHuman
    • SequenceLETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFK FIVRSRILFNQLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAA LKYLPT
    • Molecular weight37 kDa including tags
    • Amino acids698 to 803

Specifications

Our Abpromise guarantee covers the use of ab114755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 180 kDa protein downstream of CRK
    • Ced5
    • Dedicator of Cytokinesis 1
    • Dedicator of cytokinesis protein 1
    • DOCK 1
    • DOCK 180
    • DOCK1
    • DOCK1_HUMAN
    • DOCK180
    see all
  • FunctionInvolved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Functions as a guanine nucleotide exchange factor (GEF), which activates Rac Rho small GTPases by exchanging bound GDP for free GTP. Its GEF activity may be enhanced by ELMO1.
  • Tissue specificityHighly expressed in placenta, lung, kidney, pancreas and ovary. Expressed at intermediate level in thymus, testes and colon.
  • Sequence similaritiesBelongs to the DOCK family.
    Contains 1 DHR-1 (CZH-1) domain.
    Contains 1 DHR-2 (CZH-2) domain.
    Contains 1 SH3 domain.
  • DomainThe DHR-2 domain is necessary and sufficient for the GEF activity.
  • Cellular localizationCytoplasm. Membrane. Recruited to membranes via its interaction with phosphatidylinositol 3,4,5-triphosphate.
  • Information by UniProt

Recombinant Human DOCK1 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114755 at approximately 37.29kDa.

References for Recombinant Human DOCK1 protein (ab114755)

ab114755 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"