Overview

  • Product name
    Recombinant Human DOCK4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPVPL PHSLSIPVTSEPPALPPKPLAARSSHLENGARRTDPGPRPRPLPRKVSQL
    • Amino acids
      1867 to 1966
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153015 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dedicator of cytokinesis protein 4
    • Dock4
    • DOCK4_HUMAN
    • KIAA0716
  • Function
    Involved in regulation of adherens junction between cells. Functions as a guanine nucleotide exchange factor (GEF), which activates Rap1 small GTPase by exchanging bound GDP for free GTP.
  • Tissue specificity
    Widely expressed at low level. Highly expressed in skeletal muscle, prostate and ovary.
  • Sequence similarities
    Belongs to the DOCK family.
    Contains 1 DHR-1 (CZH-1) domain.
    Contains 1 DHR-2 (CZH-2) domain.
    Contains 1 SH3 domain.
  • Domain
    The DHR-2 domain probably mediates the GEF activity.
  • Cellular localization
    Endomembrane system.
  • Information by UniProt

Images

  • ab153015 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153015 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153015.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up