Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCK LDP NKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDG RAHGELHE QFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIED MQKKTQELAFATH QDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSE IPSDPKLFRHHNKLRLCF KDFTKRCEDALRKNKSLIGPDQKEYQRELE RNYHRLKEALQPLINRKIPQLYK AVLPVTCHRDSFSRMSLRKMDL
    • Amino acids1823 to 2109

Specifications

Our Abpromise guarantee covers the use of ab92221 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • FormLyophilised
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • Reconstitutionreconstitution with 69 µl aqua dest.

General Info

  • Alternative names
    • 3110056M06Rik
    • dedicator of cytokinesis 7
    • Dedicator of cytokinesis protein 7
    • Gm430
    • KIAA1771
    • MGC189434
    • mKIAA1771
    • RP23 329P19.2
    • ZIR2
    see all
  • RelevanceDOCK7 functions as a guanine nucleotide exchange factor (GEF), which activates Rac1 and Rac3 Rho small GTPases by exchanging bound GDP for free GTP. It does not have a GEF activity for CDC42. It is required for STMN1 'Ser-15' phosphorylation during axon formation and consequently for neuronal polarization.
  • Cellular localizationCell projection, axon. Note=Enriched in the developing axons of hippocampal neurons.

Recombinant Human DOCK7 protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images colored control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human DOCK7 protein (ab92221)

ab92221 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab92221.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"