Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCK LDP NKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDG RAHGELHE QFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIED MQKKTQELAFATH QDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSE IPSDPKLFRHHNKLRLCF KDFTKRCEDALRKNKSLIGPDQKEYQRELE RNYHRLKEALQPLINRKIPQLYK AVLPVTCHRDSFSRMSLRKMDL
    • Amino acids
      1823 to 2109

Specifications

Our Abpromise guarantee covers the use of ab92221 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Form
    Lyophilised
  • Additional notes
    Protein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • Reconstitution
    reconstitution with 69 µl aqua dest.

General Info

  • Alternative names
    • 3110056M06Rik
    • dedicator of cytokinesis 7
    • Dedicator of cytokinesis protein 7
    • Gm430
    • KIAA1771
    • MGC189434
    • mKIAA1771
    • RP23 329P19.2
    • ZIR2
    see all
  • Relevance
    DOCK7 functions as a guanine nucleotide exchange factor (GEF), which activates Rac1 and Rac3 Rho small GTPases by exchanging bound GDP for free GTP. It does not have a GEF activity for CDC42. It is required for STMN1 'Ser-15' phosphorylation during axon formation and consequently for neuronal polarization.
  • Cellular localization
    Cell projection, axon. Note=Enriched in the developing axons of hippocampal neurons.

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images colored control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab92221 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab92221.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up