Overview

  • Product name
    Recombinant Human DOHH protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVTEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDD SALLKHELAYCLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGD PEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPAAGPYLSVDPA PPAEERDVGRLREALLDESRPLFERYRAMFALRNAGGEEAALALAEGLHC GSALFRHEVGYVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIA RPACLAALQAHADDPERVVRESCEVALDMYEHETGRAFQYADGLEQLRGA PS
    • Amino acids
      1 to 302
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164401 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Deoxyhypusine dioxygenase
    • Deoxyhypusine hydroxylase
    • Deoxyhypusine hydroxylase/monooxygenase
    • Deoxyhypusine monooxygenase
    • Dohh
    • DOHH_HUMAN
    • hDOHH
    • HEAT like (PBS lyase) repeat containing 1
    • HEAT like PBS lyase repeat containing
    • HEAT like repeat containing protein 1
    • HEAT-like repeat-containing protein 1
    • HLRC1
    • MGC4293
    see all
  • Function
    Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)-L-lysine intermediate to form hypusine, an essential post-translational modification only found in mature eIF-5A factor.
  • Pathway
    Protein modification; eIF5A hypusination.
  • Sequence similarities
    Belongs to the deoxyhypusine hydroxylase family.
    Contains 5 HEAT-like PBS-type repeats.
  • Information by UniProt

Images

  • ab164401 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164401 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164401.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up