Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATNFSDIVKQGYVKMKSRKLGIYRRCWLVFRKSSSKGPQRLEKYPDEKS VCLRGCPKVTEISNVKCVTRLPKETKRQAVAIIFTDDSARTFTCDSELEA EEWYKTLSVECLGSRLNDISLGEPDLLAPGVQCEQTDRFNVFLLPCPNLD VYGECKLQITHENIYLWDIHNPRVKLVSWPLCSLRRYGRDATRFTFEAGR MCDAGEGLYTFQTQEGEQIYQRVHSATLAIAEQHKRVLLEMEKNVRLLNK GTEHYSYPCTPTTMLPRSAYWHHITGSQNIAEASSYAGEGYGAAQASSET DLLNRFILLKPKPSQGDSSEAKTPSQ
    • Amino acids
      1 to 326
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163187 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • docking protein 4
    • Downstream of tyrosine kinase 4
    • FLJ10488
    • insulin receptor substrate 5
    • IRS5
    see all
  • Relevance
    DOK4 (docking protein 4) belongs to the family of docking proteins which interact with receptor tyrosine kinases and mediate particular biological responses. DOK4 functions in RET mediated neurite outgrowth and plays a positive role in activation of the MAP kinase pathway.

Images

  • ab163187 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163187 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163187.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up