Recombinant Human DOLPP1 protein (ab163511)

Overview

  • Product name
    Recombinant Human DOLPP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTL IIFKRELHTISFLGGLALNEGVNWLIKNVIQEPRPCGGPHTAVGTKYGMP SSHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLSLGLLAVAFLV SYSRVYLLYHTWSQVLYGGIAGGLMAIAWFIFTQEVLTPLFPRIAAWPVS EFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ
    • Amino acids
      1 to 238
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163511 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 0610011H20Rik
    • AB030189
    • Dolichyldiphosphatase 1
    • Linked to Surfeit genes in Fugu rubripes 2
    • LSFR2
    • OTTHUMP00000022326
    • OTTHUMP00000196902
    see all
  • Relevance
    DOLPP1 is a multi-pass membrane protein(By similarity). It belongs to the dolichyldiphosphatase family. It is required for efficient N-glycosylation and is necessary for maintaining optimal levels of dolichol-linked oligosaccharides. DOLPP1 hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. It does not act on phosphatidate
  • Cellular localization
    Endoplasmic reticulum. Multipass membrane protein.

Images

  • ab163511 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163511 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163511.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up