Recombinant Human Dopamine beta Hydroxylase protein (ab114262)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DAGFLQKYFHLINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYS FAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQGRSPAGP TVVSIGGGKG
    • Molecular weight
      38 kDa including tags
    • Amino acids
      494 to 603

Specifications

Our Abpromise guarantee covers the use of ab114262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • dbh
    • DBM
    • Dopamine beta hydroxylase
    • Dopamine beta monooxygenase
    • Dopamine beta-hydroxylase (dopamine beta-monooxygenase)
    • Dopamine beta-monooxygenase
    • DOPO_HUMAN
    • OTTHUMP00000022501
    • Soluble dopamine beta-hydroxylase
    see all
  • Function
    Conversion of dopamine to noradrenaline.
  • Pathway
    Catecholamine biosynthesis; (R)-noradrenaline biosynthesis; (R)-noradrenaline from dopamine: step 1/1.
  • Involvement in disease
    Defects in DBH are the cause of dopamine beta-hydroxylase deficiency (DBH deficiency) [MIM:223360]; also known as norepinephrine deficiency or noradrenaline deficiency. This disorder is characterized by profound deficits in autonomic and cardiovascular function, but apparently only subtle signs, if any, of central nervous system dysfunction.
  • Sequence similarities
    Belongs to the copper type II ascorbate-dependent monooxygenase family.
    Contains 1 DOMON domain.
  • Cellular localization
    Cytoplasmic vesicle > secretory vesicle lumen. Cytoplasmic vesicle > secretory vesicle > chromaffin granule lumen and Cytoplasmic vesicle > secretory vesicle membrane. Cytoplasmic vesicle > secretory vesicle > chromaffin granule membrane.
  • Information by UniProt

Images

  • ab114262 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab114262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up