Overview

  • Product name
    Recombinant Human DPCD protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAVTGWLESLRTAQKTALLQDGRRKVHYLFPDGKEMAEEYDEKTSELLVR KWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIKESNANPIFMRKDTKM SFQWRIRNLPYPKDVYSVSVDQKERCIIVRTTNKKYYKKFSIPDLDRHQL PLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDC KTQ
    • Amino acids
      1 to 203
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161835 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Deleted in a mouse model of primary ciliary dyskinesia
    • DKFZp566F084
    • dpcd
    • DPCD protein
    • DPCD_HUMAN
    • OTTHUMP00000020329
    • Protein DPCD
    • RP11 529I10.4
    • RP11-529I10.4
    see all
  • Function
    May play a role in the formation or function of ciliated cells.
  • Tissue specificity
    Highly expressed in the testis. Weakly expressed in pancreas, skeletal muscle and heart. Expression increases during ciliated cell differentiation.
  • Sequence similarities
    Belongs to the DPCD family.
  • Information by UniProt

Images

  • ab161835 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161835 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161835.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up