Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQ SNCYIWMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKP DTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTN SRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDAS ILEDRDKPYACDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPV SQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGR SGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDR GYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS
    • Amino acids
      1 to 391
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159327 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Apoptosis response zinc finger protein
    • BAF45D
    • BRG1-associated factor 45D
    • D4
    • D4 zinc and double PHD fingers family 2
    • Double PHD fingers 2
    • double PHD fingers family 2
    • DPF 2
    • DPF2
    • MGC10180
    • Protein requiem
    • REQ
    • REQU_HUMAN
    • Requiem
    • Requiem apoptosis response zinc finger
    • UBI D4
    • ubi-d4
    • UBID 4
    • UBID4
    • zinc and double PHD fingers family 2
    • Zinc finger protein ubi d4
    • Zinc finger protein ubi-d4
    see all
  • Function
    May be a transcription factor required for the apoptosis response following survival factor withdrawal from myeloid cells. Might also have a role in the development and maturation of lymphoid cells.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the requiem/DPF family.
    Contains 1 C2H2-type zinc finger.
    Contains 2 PHD-type zinc fingers.
  • Cellular localization
    Nucleus. Cytoplasm. 30% nuclear. 70% cytoplasmic.
  • Information by UniProt

Images

  • ab159327 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159327 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159327.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up