Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9BQC3
    • SpeciesHuman
    • SequenceMESMFSSPAEAALQRETGVPGLLTPLPDLDGVYELERVAGFVRDLGCERV ALQFPDQLLGDAVAVAARLEETTGSKMFILGDTAYGSCCVDVLGAEQAGA QALIHFGPACLSPPARPLPVAFVLRQRSVALELCVKAFEAQNPDPKAPVV LLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFG RRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLSRLLLGWAPGQPFSSC CPDTGKTQDEGARAGRLRARRRYLVERARDARVVGLLAGTLGVAQHREAL AHLRNLTQAAGKRSYVLALGRPTPAKLANFPEVDVFVLLACPLGALAPQL SGSFFQPILAPCELEAACNPAWPPPGLAPHLTHYADLLPGSPFHVALPPP ESELWETPDVSLITGDLRPPPAWKSSNDHGSLALTPRPQLELAESSPAAS FLSSRSWQGLEPRLGQTPVTEAVSGRRGIAIAYEDEGSG
    • Molecular weight80 kDa including tags
    • Amino acids1 to 489

Specifications

Our Abpromise guarantee covers the use of ab116996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Diphthamide biosynthesis like protein 2
    • Diphthamide biosynthesis protein 2
    • Diphthamide biosynthesis protein 2 homolog like 2
    • Diphthamide biosynthesis protein 2 homolog-like 2
    • Diptheria toxin resistance protein required for diphthamide biosynthesis like 2
    • Diptheria toxin resistance protein required for diphthamide biosynthesis like 2 S. cerevisiae
    • DPH 2
    • DPH 2 homolog
    • DPH2
    • DPH2 homolog
    • DPH2 homolog S. cerevisiae
    • DPH2 like 2
    • DPH2 like 2 S. cerevisiae
    • DPH2-like 2
    • DPH2_HUMAN
    • DPH2L2
    • HsDph2
    • OTTHUMP00000010007
    • Protein DPH2 homolog
    see all
  • FunctionRequired for the first step in the synthesis of diphthamide, a post-translational modification of histidine which occurs in translation elongation factor 2.
  • Tissue specificityStrongly expressed in skeletal muscle. Moderately expressed in heart, small intestine, liver, pancreas, testis and colon. Weakly expressed in brain, placenta, kidney, speen, thymus, prostate, ovary and lymphocytes.
  • Sequence similaritiesBelongs to the DPH1/DPH2 family. DPH2 subfamily.
  • Information by UniProt

Recombinant Human DPH2 protein images

  • 12.5% SDS-PAGE showing ab116996 at approx. 79.90 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human DPH2 protein (ab116996)

ab116996 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"