Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MESMFSSPAEAALQRETGVPGLLTPLPDLDGVYELERVAGFVRDLGCERV ALQFPDQLLGDAVAVAARLEETTGSKMFILGDTAYGSCCVDVLGAEQAGA QALIHFGPACLSPPARPLPVAFVLRQRSVALELCVKAFEAQNPDPKAPVV LLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFG RRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLSRLLLGWAPGQPFSSC CPDTGKTQDEGARAGRLRARRRYLVERARDARVVGLLAGTLGVAQHREAL AHLRNLTQAAGKRSYVLALGRPTPAKLANFPEVDVFVLLACPLGALAPQL SGSFFQPILAPCELEAACNPAWPPPGLAPHLTHYADLLPGSPFHVALPPP ESELWETPDVSLITGDLRPPPAWKSSNDHGSLALTPRPQLELAESSPAAS FLSSRSWQGLEPRLGQTPVTEAVSGRRGIAIAYEDEGSG
    • Molecular weight
      80 kDa including tags
    • Amino acids
      1 to 489

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Diphthamide biosynthesis like protein 2
    • Diphthamide biosynthesis protein 2
    • Diphthamide biosynthesis protein 2 homolog like 2
    • Diphthamide biosynthesis protein 2 homolog-like 2
    • Diptheria toxin resistance protein required for diphthamide biosynthesis like 2
    • Diptheria toxin resistance protein required for diphthamide biosynthesis like 2 S. cerevisiae
    • DPH 2
    • DPH 2 homolog
    • DPH2
    • DPH2 homolog
    • DPH2 homolog S. cerevisiae
    • DPH2 like 2
    • DPH2 like 2 S. cerevisiae
    • DPH2-like 2
    • DPH2_HUMAN
    • DPH2L2
    • HsDph2
    • OTTHUMP00000010007
    • Protein DPH2 homolog
    see all
  • Function
    Required for the first step in the synthesis of diphthamide, a post-translational modification of histidine which occurs in translation elongation factor 2.
  • Tissue specificity
    Strongly expressed in skeletal muscle. Moderately expressed in heart, small intestine, liver, pancreas, testis and colon. Weakly expressed in brain, placenta, kidney, speen, thymus, prostate, ovary and lymphocytes.
  • Sequence similarities
    Belongs to the DPH1/DPH2 family. DPH2 subfamily.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116996 at approx. 79.90 kDa.
    Stained with Coomassie Blue.

References

ab116996 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up