Overview

  • Product name
    Recombinant Human DPH4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMMAVEQMPKKDWYSILGADPSANISDL KQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKRE YDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDE AEEVSLISCDTCSLIIELLHYN
    • Molecular weight
      20 kDa including tags
    • Amino acids
      1 to 148
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab156961 was purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • 1700030A21Rik
    • 2610027M02Rik
    • AV066965
    • AW240712
    • CSL type zinc finger containing protein 3
    • CSL-type zinc finger-containing protein 3
    • DJC24_HUMAN
    • DnaJ (Hsp40) homolog, subfamily C, member 24
    • DnaJ homolog subfamily C member 24
    • DNAJC24
    • DPH4 homolog
    • DPH4 homolog (JJJ3, S. cerevisiae)
    • DPH4, JJJ3 homolog
    • JJJ3
    • MmDjC7
    • RGD1564710
    • RP23-232D1.6
    • ZCSL3
    • Zinc finger, CSL domain containing 3
    • Zinc finger, CSL type containing 3
    see all
  • Function
    Stimulates the ATPase activity of several Hsp70-type chaperones.
  • Sequence similarities
    Belongs to the DPH4 family.
    Contains 1 DPH-type zinc finger.
    Contains 1 J domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156961 (3 µg).

References

ab156961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up