Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RKIISRGANFLTQILLRPGASDLTGSFRLYRKEVLEKLIEKCVSKGYVFQ MEMIVRARQLNYTIGEVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT
    • Amino acids
      161 to 260
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152916 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDGIE
    • dolichol monophosphate mannose synthase
    • Dolichol phosphate mannose synthase
    • Dolichol-phosphate mannose synthase
    • Dolichol-phosphate mannosyltransferase
    • Dolichyl phosphate beta D mannosyltransferase
    • dolichyl phosphate mannosyltransferase polypeptide 1
    • dolichyl phosphate mannosyltransferase polypeptide 1 catalytic subunit
    • Dolichyl-phosphate beta-D-mannosyltransferase
    • DPM synthase
    • DPM1
    • DPM1_HUMAN
    • Mannose P dolichol synthase
    • Mannose-P-dolichol synthase
    • MPD synthase
    • MPDS
    see all
  • Function
    Transfers mannose from GDP-mannose to dolichol monophosphate to form dolichol phosphate mannose (Dol-P-Man) which is the mannosyl donor in pathways leading to N-glycosylation, glycosyl phosphatidylinositol membrane anchoring, and O-mannosylation of proteins.
  • Pathway
    Protein modification; protein glycosylation.
  • Involvement in disease
    Defects in DPM1 are the cause of congenital disorder of glycosylation type 1E (CDG1E) [MIM:608799]. CDGs are metabolic deficiencies in glycoprotein biosynthesis that usually cause severe mental and psychomotor retardation. They are characterized by under-glycosylated serum glycoproteins. CDG1E is an autosomal recessive disorder, characterized by severe developmental delay, hypotnia, seizures, and dysmorphic features.
  • Sequence similarities
    Belongs to the glycosyltransferase 2 family.
  • Cellular localization
    Endoplasmic reticulum.
  • Information by UniProt

Images

  • ab152916 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152916 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152916.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up