Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FVTFKASRHSVSPDLKYVLLAYDVKQIFHYSYTASYVIYNIHTREVWELN PPEVEDSVLQYAAWGVQGQQL
    • Amino acids
      122 to 192
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dipeptidyl peptidase 10
    • Dipeptidyl peptidase 10 non functional
    • Dipeptidyl peptidase IV related protein 3
    • Dipeptidyl peptidase IV-related protein 3
    • Dipeptidyl peptidase like protein 2
    • Dipeptidyl peptidase X
    • Dipeptidyl peptidase-like protein 2
    • Dipeptidylpeptidase 10
    • DPL 2
    • DPL2
    • DPP 10
    • DPP X
    • Dpp10
    • DPP10_HUMAN
    • DPPY
    • DPRP 3
    • DPRP-3
    • DPRP3
    • Inactive dipeptidyl peptidase 10
    • KIAA1492
    see all
  • Function
    Has no dipeptidyl aminopeptidase activity. May modulate cell surface expression and activity of the potassium channels KCND1 and KCND2.
  • Tissue specificity
    Found in serum, T-cells and brain (at protein level). Expressed in brain, pancreas, spinal cord and adrenal glands.
  • Involvement in disease
    Genetic variations in DPP10 are associated with susceptibility to asthma (ASTHMA) [MIM:600807]. The most common chronic disease affecting children and young adults. It is a complex genetic disorder with a heterogeneous phenotype, largely attributed to the interactions among many genes and between these genes and the environment. It is characterized by recurrent attacks of paroxysmal dyspnea, with weezing due to spasmodic contraction of the bronchi.
  • Sequence similarities
    Belongs to the peptidase S9B family. DPPIV subfamily.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163610 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163610 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163610.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up