Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWKRSEQMKIKSGKCNMAAAMETEQLGVEIFETADCEENIESQDRPKLEP FYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIY YLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPLLDLFQATLDYGMYSR EEELLRERKRIGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQ PLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTREERRLT YVHNELANMEEDARSAGVATFVLQEEFDRYSGYWWCPKAETTPSGGKILR ILYEENDESEVEIIHVTSPMLETRRADSFRYPKTGTANPKVTFKMSEIMI DAEGRIIDVIDKELIQPFEILFEGVEYIARAGWTPEGKYAWSILLDRSQT RLQIVLISPELFIPVEDDVMERQRLIESVPDSVTPLIIYEETTDIWINIH DIFHVFPQSHEEEIEFIFASECKTGFRHLYKITSILKESKYKRSSGGLPA PSDFKCPIKEEIAITSGEWEVLGRHGSNIQVDEVRRLVYFEGTKDSPLEH HLYVVSYVNPGEVTRLTDRGYSHSCCISQHCDFFISKYSNQKNPHCVSLY KLSSPEDDPTCKTKEFWATILDSAGPLPDYTPPEIFSFESTTGFTLYGML YKPHDLQPGKKYPTVLFIYGGPQVQLVNNRFKGVKYFRLNTLASLGYVVV VIDNRGSCHRGLKFEGAFKYKMGQIEIDDQVEGLQYLASRYDFIDLDRVG IHGWSYGGYLSLMALMQRSDIFRVAIAGAPVTLWIFYDTGYTERYMGHPD QNEQGYYLGSVAMQAEKFPSEPNRLLLLHGFLDENVHFAHTSILLSFLVR AGKPYDLQIYPQERHSIRVPESGEHYELHLLHYLQENLGSRIAALKVI
    • Amino acids
      1 to 898
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162872 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dipeptidyl peptidase 8
    • Dipeptidyl peptidase IV-related protein 1
    • Dipeptidyl peptidase VIII
    • Dipeptidylpeptidase 8
    • DP8
    • DPP VIII
    • Dpp8
    • DPP8_HUMAN
    • DPRP-1
    • DPRP1
    • EC 3.4.14.5
    • MSTP141
    • Prolyl dipeptidase DPP8
    see all
  • Function
    Dipeptidyl peptidase that cleaves off N-terminal dipeptides from proteins having a Pro or Ala residue at position 2. May play a role in T-cell activation and immune function.
  • Tissue specificity
    Ubiquitously expressed, with highest levels in testis, placenta, prostate, muscle and brain.
  • Sequence similarities
    Belongs to the peptidase S9B family. DPPIV subfamily.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab162872 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162872 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162872.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up