Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASRWWRWRRGCSWKPAARSPGPGSPGRAVPLGPSAAAEVRAQVHRRKGL DLSQIPYINLVKHLTSACPNVCRISRFHHTTPDSKTHSGEKYTDPFKLGW RDLKGLYEDIRKELLISTSELKEMSEYYFDGKGKAFRPIIVALMARACNI HHNNSRHVQASQRAIALIAEMIHTASLVHDDVIDDASSRRGKHTVNKIWG EKKAVLAGDLILSAASIALARIGNTTVISILTQVIEDLVRGEFLQLGSKE NENERFAHYLEKTFKKTASLIANSCKAVFPRNECYDHATVQFAWRCRQSS TVCTTE
    • Amino acids
      1 to 306
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161700 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Coenzyme Q1 homolog
    • COQ1
    • Decaprenyl pyrophosphate synthetase subunit 1
    • DPS
    • hDPS1
    • Polyprenyl pyrophosphate synthetase
    • Prenyl (decaprenyl) diphosphate synthase, subunit 1
    • SPS
    • TPRT
    • TPT
    • Trans prenyltransferase
    see all
  • Relevance
    DPS1 is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. It catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in this gene are a cause of coenzyme Q10 deficiency. There are three named isoforms.
  • Cellular localization
    Mitochondrial and Plasma membrane

Images

  • ab161700 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161700 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161700.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up