Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLIS SEANEICNKSEKKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKR RKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQMQQAAQQA QLAAASASASNQAGSSQDEEDDDDI
    • Molecular weight
      20 kDa including tags
    • Amino acids
      2 to 176
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172153 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.88% Sodium chloride, 0.02% DTT, 0.32% Tris HCl

General Info

  • Alternative names
    • Down regulator of transcription 1
    • Down regulator of transcription 1 TBP binding
    • Down-regulator of transcription 1
    • down-regulator of transcription 1, TBP-binding (negative cofactor 2)
    • DR 1
    • Dr1
    • Dr1 protein
    • NC 2
    • NC2
    • NC2 beta
    • NC2-beta
    • NC2B_HUMAN
    • Negative co factor 2
    • Negative cofactor 2
    • Negative cofactor 2 beta
    • Negative cofactor 2-beta
    • Protein Dr1
    • TATA binding protein associated phosphoprotein
    • TATA box/binding protein associated phosphoprotein DR1
    • TATA-binding protein-associated phosphoprotein
    see all
  • Function
    The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
  • Sequence similarities
    Belongs to the NC2 beta/DR1 family.
    Contains 1 histone-fold domain.
  • Post-translational
    modifications
    Phosphorylation regulates its interaction with TBP. Not phosphorylated when bound to DRAP1.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab172153 in reducing (lane 1) or  non reducing conditions (lane 2)

References

ab172153 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172153.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up