Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ01658
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMASSSGNDDDLTIPRAAINKMIKETLPNVR VANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVIQALESLGF GSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKAR QQQAELAQQEWLQMQQAAQQAQLAAASASASNQAGSSQDEEDDDDI
    • Molecular weight22 kDa including tags
    • Amino acids1 to 176
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98246 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity>= 85 % SDS-PAGE.
    ab98246 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • Down regulator of transcription 1
    • Down regulator of transcription 1 TBP binding
    • Down-regulator of transcription 1
    • down-regulator of transcription 1, TBP-binding (negative cofactor 2)
    • DR 1
    • Dr1
    • Dr1 protein
    • NC 2
    • NC2
    • NC2 beta
    • NC2-beta
    • NC2B_HUMAN
    • Negative co factor 2
    • Negative cofactor 2
    • Negative cofactor 2 beta
    • Negative cofactor 2-beta
    • Protein Dr1
    • TATA binding protein associated phosphoprotein
    • TATA box/binding protein associated phosphoprotein DR1
    • TATA-binding protein-associated phosphoprotein
    see all
  • FunctionThe association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
  • Sequence similaritiesBelongs to the NC2 beta/DR1 family.
    Contains 1 histone-fold domain.
  • Post-translational
    modifications
    Phosphorylation regulates its interaction with TBP. Not phosphorylated when bound to DRAP1.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human DR1 protein images

  • 15% SDS-PAGE analysis of 3µg ab98246

References for Recombinant Human DR1 protein (ab98246)

ab98246 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98246.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"