Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDT FLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVE
    • Amino acids
      28 to 124
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160160 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Apo 3
    • Apo-3
    • Apo3
    • Apoptosis inducing receptor
    • Apoptosis inducing receptor AIR
    • Apoptosis mediating receptor
    • Apoptosis mediating receptor DR 3
    • Apoptosis mediating receptor DR3
    • Apoptosis mediating receptor TRAMP
    • Apoptosis-inducing receptor AIR
    • Apoptosis-mediating receptor DR3
    • Apoptosis-mediating receptor TRAMP
    • DDR 3
    • DDR3
    • Death domain receptor 3
    • Death domain receptor 3 soluble form
    • Death receptor 3
    • Death receptor beta
    • DR 3
    • DR3
    • LARD
    • Lymphocyte associated receptor of death
    • Lymphocyte-associated receptor of death
    • Protein WSL
    • Protein WSL-1
    • TNF receptor superfamily member 25
    • TNFR25
    • TNFRSF 12
    • TNFRSF 25
    • TNFRSF12
    • TNFRSF12, formerly
    • TNFRSF25
    • TNR25_HUMAN
    • TR 3
    • TR3
    • TRAMP
    • Translocating chain association membrane protein
    • Tumor necrosis factor receptor superfamily member 12
    • Tumor necrosis factor receptor superfamily member 25
    • Tumor necrosis factor receptor superfamily, member 12 (translocating chain association membrane protein)
    • Tumor necrosis factor receptor superfamily, member 12, formerly
    • WSL
    • WSL 1
    • WSL LR
    • WSL protein
    • WSL1
    • WSL1 protein
    • WSLLR
    see all
  • Function
    Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis.
  • Tissue specificity
    Abundantly expressed in thymocytes and lymphocytes. Detected in lymphocyte-rich tissues such as thymus, colon, intestine, and spleen. Also found in the prostate.
  • Sequence similarities
    Contains 1 death domain.
    Contains 4 TNFR-Cys repeats.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • ab160160 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160160 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160160.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up