Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSARARAGRA PGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGTQQW EHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSD EEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTP WSDIECVHKESGNGHN
    • Molecular weight
      54 kDa
    • Amino acids
      24 to 239

Specifications

Our Abpromise guarantee covers the use of ab157261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    ab157261 inhibits Human soluble TRAIL-mediated apoptosis in a concentration range of 2-10µg/ml.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes
    ab157261 binds Human and Mouse TRAIL. ab157261 inhibits Human soluble TRAIL-mediated apoptosis in a concentration range of 2-10µg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituent: 99% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 50µl sterile water. Further dilutions should be made with medium containing 5% fetal calf serum or a carrier protein. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.

General Info

  • Alternative names
    • Apo2
    • CD261
    • Cytotoxic TRAIL receptor
    • Death receptor 4
    • DR4
    • NF related apoptosis-inducing ligand receptor 1
    • TNF receptor superfamily member 10a
    • TNF-related apoptosis-inducing ligand receptor 1
    • TNFRSF10A
    • TR10A_HUMAN
    • TRAIL receptor 1
    • TRAIL-R1
    • TRAILR 1
    • TRAILR1
    • Tumor necrosis factor receptor superfamily member 10A
    • Tumor necrosis factor receptor superfamily member 10a variant 2
    • Tumor necrosis factor receptor superfamily, member 10a
    see all
  • Function
    Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B.
  • Tissue specificity
    Widely expressed. High levels are found in spleen, peripheral blood leukocytes, small intestine and thymus, but also in K562 erythroleukemia cells, MCF7 breast carcinoma cells and activated T-cells.
  • Sequence similarities
    Contains 1 death domain.
    Contains 3 TNFR-Cys repeats.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab157261 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up