Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSARARAGRA PGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGTQQW EHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSD EEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTP WSDIECVHKESGNGHN
    • Molecular weight
      24 kDa including tags
    • Amino acids
      24 to 239
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Extracellular domain

Specifications

Our Abpromise guarantee covers the use of ab174027 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    > 1.000 Eu/µg
  • Purity
    > 92 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C.

    Information available upon request.

  • Reconstitution
    It is recommended to reconstitute in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. After reconstitution store under sterile conditions for 1 month at 4°C - 8°C or 3 months at -20°C to -80°C.

General Info

  • Alternative names
    • Apo2
    • CD261
    • Cytotoxic TRAIL receptor
    • Death receptor 4
    • DR4
    • NF related apoptosis-inducing ligand receptor 1
    • TNF receptor superfamily member 10a
    • TNF-related apoptosis-inducing ligand receptor 1
    • TNFRSF10A
    • TR10A_HUMAN
    • TRAIL receptor 1
    • TRAIL-R1
    • TRAILR 1
    • TRAILR1
    • Tumor necrosis factor receptor superfamily member 10A
    • Tumor necrosis factor receptor superfamily member 10a variant 2
    • Tumor necrosis factor receptor superfamily, member 10a
    see all
  • Function
    Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B.
  • Tissue specificity
    Widely expressed. High levels are found in spleen, peripheral blood leukocytes, small intestine and thymus, but also in K562 erythroleukemia cells, MCF7 breast carcinoma cells and activated T-cells.
  • Sequence similarities
    Contains 1 death domain.
    Contains 3 TNFR-Cys repeats.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab174027 stained overnight with Coomassie Blue. DTT-reduced Protein migrates as 22-24 kDa.

References

ab174027 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174027.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up