Recombinant human DR5 protein (Fc Chimera) (ab83547)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human DR5 protein (Fc Chimera)
See all DR5 proteins and peptides -
Biological activity
The ED50 of DR5 Fc Chimera is typically 38-40 ng/ml as measured by its ability to neutralize TRAIL mediated cytotoxicity using the human leukemic Jurkat cells.
-
Purity
> 95 % SDS-PAGE. -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
Theoretical sequence: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDC ISCKYGQDY STHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEG TFREEDSPE MCRKCRTGCPRGMVKVGDCTPWSDIECVHKEGSSNTKVD KKVEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK -
Amino acids
56 to 182 -
Additional sequence information
Encodes the signal peptide and extracellular domain of human TRAIL R2 (aa 1-182) was fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modified human 293 cells.
-
Specifications
Our Abpromise guarantee covers the use of ab83547 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
Constituents: 1% Human serum albumin, 10% Trehalose
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
General Info
-
Alternative names
- Fas like protein
- Apoptosis inducing protein TRICK2A/2B
- Apoptosis inducing receptor TRAIL R2
see all -
Function
Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis. -
Tissue specificity
Widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines such as HeLaS3, K-562, HL-60, SW480, A-549 and G-361; highly expressed in heart, peripheral blood lymphocytes, liver, pancreas, spleen, thymus, prostate, ovary, uterus, placenta, testis, esophagus, stomach and throughout the intestinal tract; not detectable in brain. -
Involvement in disease
Squamous cell carcinoma of the head and neck -
Sequence similarities
Contains 1 death domain.
Contains 3 TNFR-Cys repeats. -
Cellular localization
Membrane. - Information by UniProt
Images
-
Lane 1 – MW markers; Lane 2 – ab83547; Lane 3 – ab83547 treated with PNGase F to remove potential N-linked glycans; Lane 4 – ab83547 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. Approximately 5 μg of protein was loaded per lane; Gel was stained using Coomassie.
Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A further drop in MW after treatment with the glycosidase cocktail indicates the presence of O-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes. -
A sample of ab83547 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. Approximately 40 μg of protein was loaded; Gel was stained using Deep Purple™. The spot train indicates the presence of multiple isoforms of ab83547. Spots within the spot train were cut from the gel and identified as ab83547 by protein mass fingerprinting.
-
Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates that ab83547 exists in multiple isoforms, which differ according to their level of post-translational modification. Expression of these isoforms is highly significant for cell biology, as they more closely resemble the native human proteins.
The triangle indicates theoretical pI and MW of the protein.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab83547 has not yet been referenced specifically in any publications.