Recombinant Human DREF protein (ab152028)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human DREF protein -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
NKSLESSQTDLKLVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMA QIAYSGNTSNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPE -
Predicted molecular weight
11 kDa -
Amino acids
3 to 100 -
Tags
His tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab152028 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C. Please see notes section.
pH: 7.20
Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
General Info
-
Alternative names
- Ac like transposable element
- ALTE
- BED type zinc finger domain containing protein 1
see all -
Function
Binds to 5'-TGTCG[CT]GA[CT]A-3' DNA elements found in the promoter regions of a number of genes related to cell proliferation. Binds to the histone H1 promoter and stimulates transcription. Was first identified as gene weakly similar to Ac transposable elements, but does not code for any transposase activity. -
Tissue specificity
Ubiquitously expressed at low levels. Expression is highest in skeletal muscle, heart, spleen and placenta. -
Sequence similarities
Contains 1 BED-type zinc finger. -
Cellular localization
Nucleus. In granular structures. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab152028 has not yet been referenced specifically in any publications.