Overview

  • Product nameRecombinant Human DRG1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9Y295
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSSTLAKIAEIEAEMARTQKNKATAHHLGL LKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTL LSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKG RGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIG FKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDL IDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDD LLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLI KEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK
    • Molecular weight43 kDa including tags
    • Amino acids1 to 367
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab109940 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Developmentally regulated GTP binding protein 1
    • Developmentally-regulated GTP-binding protein 1
    • DKFZp434N1827
    • DRG 1
    • DRG-1
    • DRG1
    • DRG1_HUMAN
    • NEDD 3
    • NEDD-3
    • NEDD3
    • Neural precursor cell expressed developmentally down regulated protein 3
    • Neural precursor cell expressed developmentally down-regulated protein 3
    see all
  • FunctionMay play a role in cell proliferation, differentiation and death.
  • Tissue specificityHigh levels in skeletal muscle, heart, and kidney. Intermediate levels in liver, placenta and brain. Low levels in colon, thymus, spleen, small intestine, lung and leukocytes.
  • Sequence similaritiesBelongs to the GTP1/OBG family.
    Contains 1 G (guanine nucleotide-binding) domain.
  • DomainIts C-terminal domain interacts with TAL1.
  • Post-translational
    modifications
    Polyubiquitinated; which induces proteolytic degradation and is impaired by interaction with ZC3H15.
    Sumoylated by UBE2I in response to MEKK1-mediated stimuli.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human DRG1 protein images

  • 15% SDS-PAGE analysis of 3µg ab109940.

References for Recombinant Human DRG1 protein (ab109940)

ab109940 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"