Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGA HGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      317 to 416

Specifications

Our Abpromise guarantee covers the use of ab116900 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARI3A_HUMAN
    • ARID domain containing 3A
    • ARID domain-containing protein 3A
    • ARID3A
    • AT rich interactive domain 3A (BRIGHT- like) protein
    • AT rich interactive domain 3A (BRIGHT-like)
    • AT rich interactive domain-containing protein 3A
    • AT-rich interactive domain-containing protein 3A
    • B cell regulator of IgH transcription
    • B-cell regulator of IgH transcription
    • Bright
    • dead ringer like 1
    • dead ringer, Drosophila, homolog-like 1
    • Dead ringer-like protein 1
    • DRIL1
    • DRIL3
    • DRX
    • E2F binding protein 1
    • E2F-binding protein 1
    • E2FBP1
    • Homo sapiens AT rich interactive domain 3A (BRIGHT-like)
    see all
  • Function
    Transcription factor which may be involved in the control of cell cycle progression by the RB1/E2F1 pathway and in B-cell differentiation.
  • Tissue specificity
    Widely expressed, with highest expression in skeletal muscle, thalamus, and colon.
  • Sequence similarities
    Contains 1 ARID domain.
    Contains 1 REKLES domain.
  • Cellular localization
    Nucleus. Cytoplasm. Shuttles between nucleus and cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116900 at approximately 36.63 kDa stained with Coomassie Blue.

References

ab116900 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116900.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up