Overview

  • Product name
    Recombinant Human DRIM protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LHQDQMVQKITLDCIMTYKHPHVLPYRENLQRLLEDRSFKEEIVHFSISE DNAVVKTAHRADLFPILMRILYGRMKNKTGSKTQGKSASGTRMAIVLRFL AGTQPEEI
    • Amino acids
      946 to 1053
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3830408P06Rik
    • AA617408
    • Down regulated in metastasis
    • Drim
    • mDRIM
    • mDRIN
    • Novel nucleolar protein 73
    • Protein Key-1A6
    • RGD1560606
    • Small subunit processome component 20 homolog
    • UTP20, small subunit (SSU) processome component, homolog (yeast)
    see all
  • Relevance
    DRIM, also known as UTP20, is a component of the U3 small nucleolar RNA (snoRNA) protein complex (U3 snoRNP) and is involved in 18S rRNA processing. DRIM contains 2 HEAT repeats.
  • Cellular localization
    Nucleus; nucleolus

Images

  • ab162148 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up