Recombinant Human DRIP130 protein (ab160486)

Overview

  • Product name
    Recombinant Human DRIP130 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LTVHAKMSLIHSIATRVIKLAHAKSSVALAPALVETYSRLLVYMEIESLG IKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTL
    • Amino acids
      531 to 630
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160486 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 130 kDa transcriptional co activator
    • 133 kDa transcriptional co activator
    • Activator recruited cofactor 130 kDa component
    • Activator-recruited cofactor 130 kDa component
    • ARC 130
    • ARC130
    • Cofactor required for Sp1 transcriptional activation subunit 3
    • Cofactor required for Sp1 transcriptional activation subunit 3 130kDa
    • Cofactor required for Sp1 transcriptional activation subunit 3 130kDa mediator
    • CRSP 130
    • CRSP 130 kD subunit
    • CRSP 133
    • CRSP 3
    • CRSP complex subunit 3
    • CRSP130
    • CRSP133
    • CRSP3
    • CRSP3 protein
    • DKFZp434H0117
    • DRIP 130
    • DRIP130
    • hSur-2
    • KIAA1216
    • MED 23
    • med23
    • MED23_HUMAN
    • Mediator complex subunit 23
    • Mediator of RNA polymerase II transcription subunit 23
    • MRT18
    • Protein sur-2 homolog
    • SUR 2
    • SUR2
    • Transcriptional co activator CRSP 130
    • Transcriptional co activator CRSP130
    • Transcriptional coactivator CRSP130
    • Vitamin D3 receptor interacting protein
    • Vitamin D3 receptor interacting protein complex 130 kDa component
    • Vitamin D3 receptor-interacting protein complex 130 kDa component
    see all
  • Function
    Required for transcriptional activation subsequent to the assembly of the preinitiation complex (By similarity). Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for transcriptional activation by adenovirus E1A protein. Required for ELK1-dependent transcriptional activation in response to activated Ras signaling.
  • Sequence similarities
    Belongs to the Mediator complex subunit 23 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160486 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160486 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160486.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up