Recombinant Human DRP1 protein (ab153041)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
Description
-
Product name
Recombinant Human DRP1 protein -
Expression system
Wheat germ -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDL LPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKL YTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGM TKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKIS REVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQL DINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDC LPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEG TAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNAT GPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYS TQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPD FADACGLMNNNIEEQRRNRLARELPSAVSRDKLIQDSRRETKNVASGGGG VGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLL DVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVN HVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQI IAEIRETHLW -
Amino acids
1 to 710 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab153041 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- DLP1
- dnm1l
- DNM1L_HUMAN
see all -
Function
Functions in mitochondrial and peroxisomal division. Mediates membrane fission through oligomerization into ring-like structures which wrap around the scission site to constict and sever the mitochondrial membrane through a GTP hydrolysis-dependent mechanism. Required for normal brain development. Facilitates developmentally-regulated apoptosis during neural tube development. Required for a normal rate of cytochrome c release and caspase activation during apoptosis. Also required for mitochondrial fission during mitosis. May be involved in vesicle transport.
Isoform 1 and isoform 4 inhibit peroxisomal division when overexpressed. -
Tissue specificity
Ubiquitously expressed with highest levels found in skeletal muscles, heart, kidney and brain. Isoform 1 is brain-specific. Isoform 2 and isoform 3 are predominantly expressed in testis and skeletal muscles respectively. Isoform 4 is weakly expressed in brain, heart and kidney. Isoform 5 is dominantly expressed in liver, heart and kidney. Isoform 6 is expressed in neurons. -
Involvement in disease
Note=May be associated with Alzheimer disease through beta-amyloid-induced increased S-nitrosylation of DNM1L, which triggers, directly or indirectly, excessive mitochondrial fission, synaptic loss and neuronal damage. -
Sequence similarities
Belongs to the dynamin family.
Contains 1 GED domain. -
Domain
The GED domain folds back to interact, in cis, with the GTP-binding domain and middle domain, and interacts, in trans, with the GED domains of other DNM1L molecules, and is thus critical for activating GTPase activity and for DNM1L dimerization. -
Post-translational
modificationsPhosphorylation/dephosphorylation events on two sites near the GED domain regulate mitochondrial fission. Phosphorylation on Ser-637 inhibits mitochondrial fissin probably through preventing intramolecular interaction. Dephosphorylated on this site by PPP3CA which promotes mitochondrial fission. Phosphorylation on Ser-616 also promotes mitochondrial fission.
Sumoylated on various lysine residues within the B domain. Desumoylated by SENP5 during G2/M transition of mitosis. Appears to be linked to its catalytic activity.
S-nitrosylation increases DNM1L dimerization, mitochondrial fission and causes neuronal damage.
Ubiquitination by MARCH5 affects mitochondrial morphology. -
Cellular localization
Cytoplasm > cytosol. Golgi apparatus. Endomembrane system. Mainly cytosolic. Translocated to the mitochondrial membrane through interaction with FIS1. Colocalized with MARCH5 at mitochondrial membrane. Localizes to mitochondria at sites of division. Associated with peroxisomal membranes, partly recruited there by PEX11B. May also be associated with endoplasmic reticulum tubules and cytoplasmic vesicles and found to be perinuclear. In some cell types, localizes to the Golgi complex. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (2)
ab153041 has been referenced in 2 publications.
- Li W et al. Nitration of Drp1 provokes mitophagy activation mediating neuronal injury in experimental autoimmune encephalomyelitis. Free Radic Biol Med 143:70-83 (2019). PubMed: 31377418
- Geng J et al. Andrographolide alleviates Parkinsonism in MPTP-PD mice via targeting mitochondrial fission mediated by dynamin-related protein 1. Br J Pharmacol 176:4574-4591 (2019). PubMed: 31389613