Overview

  • Product name
    Recombinant Human Dscam protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KDVQNEDGLYNYRCITRHRYTGETRQSNSARLFVSDPANSAPSILDGFDH RKAMAGQRVELPCKALGHPEPDYRWLKDNMPLELSGRF
    • Molecular weight
      35 kDa including tags
    • Amino acids
      184 to 271

Specifications

Our Abpromise guarantee covers the use of ab116817 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CHD2
    • CHD2 42
    • CHD2 52
    • Down syndrome cell adhesion molecule
    • DSCAM
    • DSCAM_HUMAN
    • human CHD2-52 down syndrome cell adhesion molecule 2, 9
    • OTTHUMP00000109193 2
    • SD11109p
    see all
  • Function
    Cell adhesion molecule that plays a role in neuronal self-avoidance. Promotes repulsion between specific neuronal processes of either the same cell or the same subtype of cells. Mediates within retinal amacrine and ganglion cell subtypes both isoneuronal self-avoidance for creating an orderly dendritic arborization and heteroneuronal self-avoidance to maintain the mosaic spacing between amacrine and ganglion cell bodies. Receptor for netrin required for axon guidance independently of and in collaboration with the receptor DCC. In spinal chord development plays a role in guiding commissural axons projection and pathfinding across the ventral midline to reach the floor plate upon ligand binding. Enhances netrin-induced phosphorylation of PAK1 and FYN. Mediates intracellular signaling by stimulating the activation of MAPK8 and MAP kinase p38.
  • Tissue specificity
    Primarily expressed in brain.
  • Sequence similarities
    Contains 6 fibronectin type-III domains.
    Contains 10 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain
    Ig-like C2-type domains 7 to 9 are sufficient for interaction with NTN1 and commissural axon outgrowth. The transmembrane domain is necessary for interaction with DCC.
  • Post-translational
    modifications
    Phosphorylated at tyrosine residues. Phosphorylation is enhanced by netrin.
  • Cellular localization
    Secreted and Cell membrane. Localized in the soma, cell membrane, axon and growth cone of dissociated commissural axons.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116817 at approximately 35.31kDa.
    Stained with Coomassie Blue.

References

ab116817 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116817.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up